| Edit |   |
| Antigenic Specificity | PNMA6A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PNMA6A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNMA6A. This antibody reacts with human. The PNMA6A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PNMA6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF |
| Other Names | MA6, MGC15827, paraneoplastic antigen like 6A, PNMA6 |
| Gene, Accession # | PNMA6C, Gene ID: 84968, Accession: P0CZ20 |
| Catalog # | NBP2-46708 |
| Price | |
| Order / More Info | PNMA6A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |