| Edit |   |
| Antigenic Specificity | PNMA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PNMA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNMA3. This antibody reacts with human. The PNMA3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PNMA3(paraneoplastic antigen MA3) The peptide sequence was selected from the N terminal of PNMA3. Peptide sequence QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM. |
| Other Names | MA3MA5, MGC132756, MGC132758, paraneoplastic antigen MA3, paraneoplastic cancer-testis-brain antigen |
| Gene, Accession # | PNMA3, Gene ID: 29944, Accession: Q9UL41, SwissProt: Q9UL41 |
| Catalog # | NBP1-52929-20ul |
| Price | |
| Order / More Info | PNMA3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |