| Edit |   |
| Antigenic Specificity | CPNE9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CPNE9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPNE9. This antibody reacts with human. The CPNE9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CPNE9(copine family member IX) The peptide sequence was selected from the middle region of CPNE9. Peptide sequence YDRTVKIDVYDWDRDGSHDFIGEFTTSYRELSKAQNQFTVYEVLNPRKKC. |
| Other Names | copine family member IX, copine IX |
| Gene, Accession # | CPNE9, Gene ID: 151835 |
| Catalog # | NBP1-70508-20ul |
| Price | |
| Order / More Info | CPNE9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |