| 产品详情 |
| Edit |   |
| Antigenic Specificity | Carboxyl Ester Lipase/CEL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Carboxyl Ester Lipase/CEL Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carboxyl Ester Lipase/CEL. This antibody reacts with human. The Carboxyl Ester Lipase/CEL Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CEL(carboxyl ester lipase (bile salt-stimulated lipase)) The peptide sequence was selected from the middle region of CEL. Peptide sequence VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR. |
| Other Names | BAL, bile salt-activated lipase, Bile salt-stimulated lipase, BSDL, BSSLbile salt-dependent lipase, oncofetal isoform, bucelipase, carboxyl ester hydrolase, Carboxyl ester lipase, carboxyl ester lipase (bile salt-stimulated lipase), CEase, CELL, Cholesterol esterase, EC 3.1.1, EC 3.1.1.13, EC 3.1.1.3, FAP, FAPP, fetoacinar pancreatic protein, LIPA, lysophospholipase, pancreatic, MODY8bile-salt-activated lipase, Pancreatic lysophospholipase, Sterol esterase |
| Gene, Accession # | CEL, Gene ID: 1056 |
| Catalog # | NBP1-57922 |
| Price | |
| Order / More Info | Carboxyl Ester Lipase/CEL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|