| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHD4 |
|---|
| Clone | 4H4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 100 ug |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHD4 Antibody (4H4) from Novus Biologicals is a mouse monoclonal antibody to CHD4. This antibody reacts with human. The CHD4 Antibody (4H4) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | CHD4 (NP_001264 1632 a.a. - 1730 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH |
|---|
| Other Names | ATP-dependent helicase CHD4, CHD-4, chromodomain helicase DNA binding protein 4, chromodomain-helicase-DNA-binding protein 4, DKFZp686E06161, EC 3.6.1, EC 3.6.4.12, Mi-2 autoantigen 218 kDa protein, Mi-2b, Mi2-BETA |
|---|
| Gene, Accession # | CHD4, Gene ID: 1108, Accession: NP_001264, SwissProt: NP_001264 |
|---|
| Catalog # | H00001108-M01-100ug |
|---|
| Price | |
|---|
| Order / More Info | CHD4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25190814 |
|---|
| 产品资料 |
|
|