| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHD3 |
|---|
| Clone | 5E12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHD3 Antibody (5E12) from Novus Biologicals is a mouse monoclonal antibody to CHD3. This antibody reacts with human. The CHD3 Antibody (5E12) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | CHD3 (NP_001005273 1654 a.a. - 1741 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH |
|---|
| Other Names | ATP-dependent helicase CHD3, CHD-3, chromodomain helicase DNA binding protein 3, chromodomain-helicase-DNA-binding protein 3, EC 3.6.1, EC 3.6.4.12, hZFH, Mi-2 autoantigen 240 kDa protein, Mi-2a, Mi2-ALPHA, ZFH, Zinc finger helicase, zinc-finger helicase (Snf2-like) |
|---|
| Gene, Accession # | CHD3, Gene ID: 1107, Accession: NP_001005273, SwissProt: NP_001005273 |
|---|
| Catalog # | H00001107-M01 |
|---|
| Price | |
|---|
| Order / More Info | CHD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|