| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PARD3/Par3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in the literature (PMID:28923978). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PARD3/Par3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PARD3/Par3. This antibody reacts with human, mouse. The PARD3/Par3 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR |
|---|
| Other Names | FLJ21015, par-3 partitioning defective 3 homolog (C. elegans), PAR3A, PAR3C.elegans) homolog |
|---|
| Gene, Accession # | PARD3, Gene ID: 56288 |
|---|
| Catalog # | NBP1-88861-25ul |
|---|
| Price | |
|---|
| Order / More Info | PARD3/Par3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24164893, 28350047, 28923978 |
|---|
| 产品资料 |
|
|