| 产品详情 |
| Edit |   |
| Antigenic Specificity | PARD3/Par3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in the literature (PMID:28923978). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PARD3/Par3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PARD3/Par3. This antibody reacts with human, mouse. The PARD3/Par3 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse PARD3/Par3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR |
| Other Names | FLJ21015, par-3 partitioning defective 3 homolog (C. elegans), PAR3A, PAR3C.elegans) homolog |
| Gene, Accession # | PARD3, Gene ID: 56288 |
| Catalog # | NBP1-88861 |
| Price | |
| Order / More Info | PARD3/Par3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24164893, 28350047, 28923978 |
| 产品资料 |
|
|