| Edit |   |
|---|
| Antigenic Specificity | Chromosome 21 Open Reading Frame 33 (C21orf33) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C21orf33 inhibits both estrogen- and heregulin-beta1-stimulated growth of breast cancer cells, and further suggests that growth inhibition induced in these cells by all-trans retinoic acid occurs via HES-1-mediated downregulation of E2F-1 expression. C21orf33 may also be a candidate protein involved in the pathogenesis of the brain deficit in DS. |
|---|
| Immunogen | C21 ORF33 antibody was raised using the N terminal Of C21 rf33 corresponding to a region with amino acids SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL |
|---|
| Other Names | C21orf33|es1|knph|knpi|ES1|GT335|HES1|KNPH|KNPI |
|---|
| Gene, Accession # | Gene ID: 8209 |
|---|
| Catalog # | ABIN630137 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 21 Open Reading Frame 33 (C21orf33) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|