| Edit |   |
|---|
| Antigenic Specificity | Chromosome 2 Open Reading Frame 29 (C2orf29) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | C2 ORF29 antibody was raised using the N terminal Of C2 rf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP |
|---|
| Other Names | C2orf29|c2orf29 |
|---|
| Gene, Accession # | Gene ID: 55571 |
|---|
| Catalog # | ABIN632925 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 2 Open Reading Frame 29 (C2orf29) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|