Edit |   |
Antigenic Specificity | Chromosome 14 Open Reading Frame 80 (C14ORF80) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The specific function of C14orf80 is not yet known. |
Immunogen | C14 ORF80 antibody was raised using the N terminal Of C14 rf80 corresponding to a region with amino acids MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ |
Other Names | n/a |
Gene, Accession # | Gene ID: 283643 |
Catalog # | ABIN632833 |
Price | |
Order / More Info | Chromosome 14 Open Reading Frame 80 (C14ORF80) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |