Edit |   |
Antigenic Specificity | Chromosome 14 Open Reading Frame 180 (C14orf180) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known. |
Immunogen | C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA |
Other Names | C14orf77|NRAC |
Gene, Accession # | Gene ID: 400258 |
Catalog # | ABIN635016 |
Price | |
Order / More Info | Chromosome 14 Open Reading Frame 180 (C14orf180) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |