Edit |   |
Antigenic Specificity | Chromosome 12 Open Reading Frame 42 (C12orf42) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of C12orf42 protein has not been widely studied, and is yet to be fully elucidated. |
Immunogen | C12 ORF42 antibody was raised using the N terminal Of C12 rf42 corresponding to a region with amino acids PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK |
Other Names | n/a |
Gene, Accession # | Gene ID: 374470 |
Catalog # | ABIN632789 |
Price | |
Order / More Info | Chromosome 12 Open Reading Frame 42 (C12orf42) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |