Edit |   |
Antigenic Specificity | Chromosome 10 Open Reading Frame 54 (C10orf54) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | C10ORF54 may be involved in protein binding and receptor activity. |
Immunogen | C10 ORF54 antibody was raised using the N terminal Of C10 rf54 corresponding to a region with amino acids TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE |
Other Names | MGC112715|MGC151567|B7-H5|B7H5|GI24|PP2135|SISP1|Dies1|VISTA |
Gene, Accession # | Gene ID: 64115 |
Catalog # | ABIN635024 |
Price | |
Order / More Info | Chromosome 10 Open Reading Frame 54 (C10orf54) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |