| Edit |   |
|---|
| Antigenic Specificity | Chromosome 9 Open Reading Frame 43 (C9orf43) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of the C9orf43 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
| Immunogen | C9 ORF43 antibody was raised using the middle region of C9 rf43 corresponding to a region with amino acids PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE |
|---|
| Other Names | C9orf43 |
|---|
| Gene, Accession # | Gene ID: 257169 |
|---|
| Catalog # | ABIN632984 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 9 Open Reading Frame 43 (C9orf43) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|