| Edit |   |
|---|
| Antigenic Specificity | Chromosome 8 Open Reading Frame 84 (C8orf84) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown. |
|---|
| Immunogen | RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI |
|---|
| Other Names | C8orf84|RPESP|C14H8orf84|Gm106|Rpesp|RGD1559717 |
|---|
| Gene, Accession # | Gene ID: 157869,226866,297757 |
|---|
| Catalog # | ABIN632147 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 8 Open Reading Frame 84 (C8orf84) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|