Edit |   |
Antigenic Specificity | Chromosome 8 Open Reading Frame 45 (C8orf45) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of Chromosome 8 ORF protein is not widely studied, and is yet to be elucidated fully. |
Immunogen | C8 orf45 antibody was raised using the middle region of C8 rf45 corresponding to a region with amino acids IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE |
Other Names | C8orf45|6030422M02Rik |
Gene, Accession # | Gene ID: 157777 |
Catalog # | ABIN633137 |
Price | |
Order / More Info | Chromosome 8 Open Reading Frame 45 (C8orf45) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |