Edit |   |
Antigenic Specificity | ZNF790 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-ZNF790 Antibody |
Immunogen | The immunogen for anti-ZNF790 antibody: synthetic peptide directed towards the N terminal of human ZNF790. Synthetic peptide located within the following region: CKNHSLDCLCFRGDWEGNTQFQTLQDNQEECFKQVIRTCEKRPTFNQHTV |
Other Names | n/a |
Gene, Accession # | ZN790, Accession: NM_206894 |
Catalog # | TA339846 |
Price | |
Order / More Info | ZNF790 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |