| Edit |   |
|---|
| Antigenic Specificity | MFSD2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-MFSD2B Antibody |
|---|
| Immunogen | The immunogen for anti-MFSD2B antibody is: synthetic peptide directed towards the C-terminal region of Human MFSD2B. Synthetic peptide located within the following region: VCKQAEEVVVTLKVLIGAVPTCMILAGLCILMVGSTPKTPSRDASSRLSL |
|---|
| Other Names | major facilitator superfamily domain containing 2B |
|---|
| Gene, Accession # | MFSD2B, Accession: NM_001080473 |
|---|
| Catalog # | TA334891 |
|---|
| Price | |
|---|
| Order / More Info | MFSD2B Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|