| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Munc18-1/STXBP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (predicted: hamster) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences. |
|---|
| Other Names | Syntaxin-binding protein 1;MUNC18-1;N-Sec1;Protein unc-18 homolog 1;Unc18-1;Protein unc-18 homolog A;Unc-18A;p67;STXBP1;UNC18A; |
|---|
| Gene, Accession # | STXBP1, UniProt: P61764 |
|---|
| Catalog # | PB9819 |
|---|
| Price | |
|---|
| Order / More Info | Munc18-1/STXBP1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|