Edit |   |
Antigenic Specificity | PUS7L |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-PUS7L Antibody |
Immunogen | The immunogen for Anti-PUS7L Antibody is: synthetic peptide directed towards the N-terminal region of Human PUS7L. Synthetic peptide located within the following region: FKISEIQLEPNNFPKKPKLDLQNLSLEDGRNQEVHTLIKYTDGDQNHQSG |
Other Names | pseudouridylate synthase 7 homolog (S. cerevisiae)-like |
Gene, Accession # | PUS7L, Accession: NM_031292 |
Catalog # | TA331701 |
Price | |
Order / More Info | PUS7L Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |