Edit |   |
Antigenic Specificity | GNA13 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-GNA13 Antibody |
Immunogen | The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: SREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTI |
Other Names | G13, guanine nucleotide binding protein (G protein), alpha 13 |
Gene, Accession # | GNA13, Accession: NM_006572 |
Catalog # | TA331257 |
Price | |
Order / More Info | GNA13 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |