| Edit |   |
|---|
| Antigenic Specificity | ESX1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-ESX1 Antibody |
|---|
| Immunogen | The immunogen for anti-ESX1 antibody: synthetic peptide directed towards the N terminal of mouse ESX1. Synthetic peptide located within the following region: MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES |
|---|
| Other Names | ESX1L, ESXR1, ESX homeobox 1 |
|---|
| Gene, Accession # | ESX1, Accession: NM_007957 |
|---|
| Catalog # | TA341760 |
|---|
| Price | |
|---|
| Order / More Info | ESX1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|