| Edit |   |
|---|
| Antigenic Specificity | COA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-COA1 Antibody |
|---|
| Immunogen | The immunogen for Anti-COA1 antibody is: synthetic peptide directed towards the C-terminal region of Human COA1. Synthetic peptide located within the following region: KSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE |
|---|
| Other Names | C7orf44, MITRAC15, cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae) |
|---|
| Gene, Accession # | COA1, Accession: NM_018224 |
|---|
| Catalog # | TA330693 |
|---|
| Price | |
|---|
| Order / More Info | COA1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|