Edit |   |
Antigenic Specificity | SCX |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 91%, rat 91%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human SCX polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSFATLRPAPPGRYLYPEVSPLSEDEDRGSDSSGSDEKPCRVH |
Other Names | scleraxis bHLH transcription factor, bHLHa41, bHLHa48, SCXA, SCXB |
Gene, Accession # | Gene ID: 642658, UniProt: Q7RTU7, ENSG00000260428 |
Catalog # | HPA043183 |
Price | |
Order / More Info | SCX Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |