Edit |   |
Antigenic Specificity | ART5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal anti-ART5 antibody |
Immunogen | The immunogen for anti-ART5 antibody: synthetic peptide directed towards the middle region of human ART5. Synthetic peptide located within the following region: VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE |
Other Names | ARTC5, ADP-ribosyltransferase 5 |
Gene, Accession # | NAR5, Accession: NM_001079536 |
Catalog # | TA329570 |
Price | |
Order / More Info | ART5 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |