Edit |   |
Antigenic Specificity | ARSJ |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, dog, horse, bovine |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-ARSJ Antibody |
Immunogen | The immunogen for Anti-ARSJ Antibody is: synthetic peptide directed towards the C-terminal region of Human ARSJ. Synthetic peptide located within the following region: VWGPWYKEETKKKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG |
Other Names | arylsulfatase family, member J |
Gene, Accession # | ARSJ, Accession: NM_024590 |
Catalog # | TA333678 |
Price | |
Order / More Info | ARSJ Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |