Edit |   |
Antigenic Specificity | NKPD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat, bovine, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-NKPD1 Antibody |
Immunogen | The immunogen for Anti-NKPD1 antibody is: synthetic peptide directed towards the N-terminal region of Human NKPD1. Synthetic peptide located within the following region: AMARSGPALPSAAGVLLKPSEPTDARPLPAPAACGSFTAYSSDILTEDDV |
Other Names | NTPase, KAP family P-loop domain containing1 |
Gene, Accession # | NKPD1, Accession: NM_198478 |
Catalog # | TA337467 |
Price | |
Order / More Info | NKPD1 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |