Edit |   |
Antigenic Specificity | RNF149 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-RNF149 Antibody |
Immunogen | The immunogen for Anti-RNF149 antibody is: synthetic peptide directed towards the C-terminal region of Human RNF149. Synthetic peptide located within the following region: LLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL |
Other Names | DNAPTP2, ring finger protein 149 |
Gene, Accession # | RNF149, Accession: NM_173647 |
Catalog # | TA330526 |
Price | |
Order / More Info | RNF149 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |