Edit |   |
Antigenic Specificity | Rnf122 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-Rnf122 Antibody |
Immunogen | The immunogen for anti-Rnf122 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKG |
Other Names | ring finger protein 122 |
Gene, Accession # | Rnf122, Accession: NM_175136 |
Catalog # | TA330470 |
Price | |
Order / More Info | Rnf122 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |