Edit |   |
Antigenic Specificity | RNF115 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-RNF115 Antibody |
Immunogen | The immunogen for anti-ZNF364 antibody: synthetic peptide directed towards the C terminal of human ZNF364. Synthetic peptide located within the following region: PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF |
Other Names | BCA2, ZNF364, ring finger protein 115 |
Gene, Accession # | RNF115, Accession: NM_014455 |
Catalog # | TA329840 |
Price | |
Order / More Info | RNF115 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |