Edit |   |
Antigenic Specificity | GSG1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-GSG1 Antibody |
Immunogen | The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the C terminal of human GSG1. Synthetic peptide located within the following region: VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQP |
Other Names | germ cell associated 1 |
Gene, Accession # | GSG1, Accession: NM_153823 |
Catalog # | TA335371 |
Price | |
Order / More Info | GSG1 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |