Edit |   |
Antigenic Specificity | GRXCR2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-GRXCR2 Antibody |
Immunogen | The immunogen for Anti-GRXCR2 antibody is: synthetic peptide directed towards the C-terminal region of Human GRXCR2. Synthetic peptide located within the following region: PLVEAESTLPQNRYTQEGDIPEDSCFHCRGSGSATCSLCHGSKFSMLANR |
Other Names | DFNB101, glutaredoxin, cysteine rich 2 |
Gene, Accession # | GRCR2, Accession: NM_001080516 |
Catalog # | TA337334 |
Price | |
Order / More Info | GRXCR2 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |