Edit |   |
Antigenic Specificity | RIPPLY1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, horse, bovine, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-RIPPLY1 Antibody |
Immunogen | The immunogen for Anti-RIPPLY1 Antibody is: synthetic peptide directed towards the middle region of Human RIPPLY1. Synthetic peptide located within the following region: RPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRS |
Other Names | ripply transcriptional repressor 1 |
Gene, Accession # | RIPPLY1, Accession: NM_138382 |
Catalog # | TA333545 |
Price | |
Order / More Info | RIPPLY1 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |