Edit |   |
Antigenic Specificity | Ecsit |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-Ecsit Antibody |
Immunogen | The immunogen for anti-Ecsit antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN |
Other Names | SITPEC, ECSIT signalling integrator |
Gene, Accession # | Ecsit, Accession: NM_012029 |
Catalog # | TA342302 |
Price | |
Order / More Info | Ecsit Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |