Edit |   |
Antigenic Specificity | Ebf4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal anti-Ebf4 antibody |
Immunogen | The immunogen for anti-Ebf4 antibody: synthetic peptide directed towards the middle region of human Ebf4. Synthetic peptide located within the following region: ARSCGSASPRFAPSPGSQQSSYGSGLGAGLGSYGAPGVTGLGVPGSPSFL |
Other Names | COE4, O/E4, early B-cell factor 4 |
Gene, Accession # | Ebf4, Accession: NM_152993 |
Catalog # | TA329589 |
Price | |
Order / More Info | Ebf4 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |