Edit |   |
Antigenic Specificity | EAPP - N-terminal region |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | rat; human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-EAPP Antibody - N-terminal region |
Immunogen | The immunogen for Anti-Eapp antibody is: synthetic peptide directed towards the N-terminal region of Rat Eapp. Synthetic peptide located within the following region: PALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSEDEFEKEMEAELNS |
Other Names | BM036, C14orf11, E2F-associated phosphoprotein |
Gene, Accession # | EAPP, Accession: NM_018453 |
Catalog # | TA344860 |
Price | |
Order / More Info | EAPP - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |