| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBMS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBMS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBMS1. This antibody reacts with human. The RBMS1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human RBMS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP |
|---|
| Other Names | chromosome 2 open reading frame 12, DKFZp564H0764, HCC-4, MGC15146, MGC3331, MGC97258, MGC97270, MGC97282, MGC99543, MSSP1, MSSP-1, MSSP-2, MSSP-3, RNA binding motif, single stranded interacting protein 1, SCR2MGC70597, single-stranded-interacting protein 1, suppressor of cdc 2 (cdc13) with RNA binding motif 2 |
|---|
| Gene, Accession # | RBMS1, Gene ID: 5937 |
|---|
| Catalog # | NBP2-57279 |
|---|
| Price | |
|---|
| Order / More Info | RBMS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|