Edit |   |
Antigenic Specificity | MESDC1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, bovine, horse, rat, mouse, dog |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-MESDC1 Antibody |
Immunogen | The immunogen for Anti-MESDC1 Antibody is: synthetic peptide directed towards the N-terminal region of Human MESDC1. Synthetic peptide located within the following region: AIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPASSGA |
Other Names | mesoderm development candidate 1 |
Gene, Accession # | MESD1, Accession: NM_022566 |
Catalog # | TA331769 |
Price | |
Order / More Info | MESDC1 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |