Edit |   |
Antigenic Specificity | MGC50273 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Anti-MGC50273 Antibody |
Immunogen | The immunogen for anti-MGC50273 antibody: synthetic peptide directed towards the N terminal of human MGC50273. Synthetic peptide located within the following region: MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE |
Other Names | chromosome 2 open reading frame 27B |
Gene, Accession # | C2orf27B, Accession: NM_214461 |
Catalog # | TA335120 |
Price | |
Order / More Info | MGC50273 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |