Edit |   |
Antigenic Specificity | MGC48628 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | bovine, human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Anti-MGC48628 Antibody |
Immunogen | The immunogen for anti-MGC48628 antibody: synthetic peptide directed towards the N terminal of human MGC48628. Synthetic peptide located within the following region: HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS |
Other Names | FAM190A, coiled-coil serine-rich protein 1 |
Gene, Accession # | CCSER1, Accession: NM_207491 |
Catalog # | TA335111 |
Price | |
Order / More Info | MGC48628 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |