Edit |   |
Antigenic Specificity | MGC45491 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Anti-MGC45491 Antibody |
Immunogen | The immunogen for anti-MGC45491 antibody: synthetic peptide directed towards the middle region of human MGC45491. Synthetic peptide located within the following region: CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPL |
Other Names | chromosome 6 open reading frame 223 |
Gene, Accession # | C6orf223, Accession: NM_001171992 |
Catalog # | TA330934 |
Price | |
Order / More Info | MGC45491 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |