Edit |   |
Antigenic Specificity | MGC34821 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Anti-MGC34821 Antibody |
Immunogen | The immunogen for anti-MGC34821 antibody: synthetic peptide directed towards the middle region of human MGC34821. Synthetic peptide located within the following region: VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF |
Other Names | NET46, solute carrier family 22, member 24 |
Gene, Accession # | S22AO, Accession: NM_001136506 |
Catalog # | TA335126 |
Price | |
Order / More Info | MGC34821 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |