Edit |   |
Antigenic Specificity | GNL3L - N-terminal region |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | bovine, human, mouse, porcine, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB,IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region |
Immunogen | The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN |
Other Names | guanine nucleotide binding protein-like 3 (nucleolar)-like |
Gene, Accession # | GNL3L, Accession: NM_019067 |
Catalog # | TA344199 |
Price | |
Order / More Info | GNL3L - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |