Edit |   |
Antigenic Specificity | CGRRF1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal anti-CGRRF1 antibody |
Immunogen | The immunogen for anti-CGRRF1 antibody: synthetic peptide directed towards the middle region of human CGRRF1. Synthetic peptide located within the following region: KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS |
Other Names | CGR19, RNF197, cell growth regulator with ring finger domain 1 |
Gene, Accession # | CGRRF1, Accession: NM_006568 |
Catalog # | TA329565 |
Price | |
Order / More Info | CGRRF1 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |