| 产品详情 |
| Edit |   |
| Antigenic Specificity | CASC4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CASC4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CASC4. This antibody reacts with human. The CASC4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CASC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG |
| Other Names | cancer susceptibility candidate 4, Cancer susceptibility candidate gene 4 protein, DKFZp459F1927, gene associated with HER-2/neu overexpression, H63, MGC74708, protein CASC4 |
| Gene, Accession # | CASC4, Gene ID: 113201, Accession: Q6P4E1, SwissProt: Q6P4E1 |
| Catalog # | NBP2-30507 |
| Price | |
| Order / More Info | CASC4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|