| Edit |   |
|---|
| Antigenic Specificity | Taf6l |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal anti-Taf6l antibody |
|---|
| Immunogen | The immunogen for anti-Taf6l antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS |
|---|
| Other Names | PAF65A, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa |
|---|
| Gene, Accession # | Taf6l, Accession: NM_001107575 |
|---|
| Catalog # | TA329306 |
|---|
| Price | |
|---|
| Order / More Info | Taf6l Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|