| Edit |   |
|---|
| Antigenic Specificity | C2orf71 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, bovine, zebrafish, guinea pig, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-C2orf71 Antibody |
|---|
| Immunogen | The immunogen for Anti-C2orf71 antibody is: synthetic peptide directed towards the C-terminal region of Human C2orf71. Synthetic peptide located within the following region: SPCSPELQGGTRRASPPEFCVLGHGLQPEPRTGHIQDKSQPEAQPQQEEV |
|---|
| Other Names | RP54, chromosome 2 open reading frame 71 |
|---|
| Gene, Accession # | C2orf71, Accession: NM_001029883 |
|---|
| Catalog # | TA331376 |
|---|
| Price | |
|---|
| Order / More Info | C2orf71 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|