Edit |   |
Antigenic Specificity | C2orf70 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, horse, rabbit, dog, bovine |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-C2orf70 Antibody |
Immunogen | The immunogen for anti-C2orf70 antibody is: synthetic peptide directed towards the C-terminal region of Human C2orf70. Synthetic peptide located within the following region: TVLPPLCPKKKWHLLRLAPENLKTYQTFPSGKRVSPQERKKRDCYFEFRA |
Other Names | chromosome 2 open reading frame 70 |
Gene, Accession # | C2orf70, Accession: NM_001105519 |
Catalog # | TA334860 |
Price | |
Order / More Info | C2orf70 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |