Edit |   |
Antigenic Specificity | GLIS2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 100ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal anti-GLIS2 antibody |
Immunogen | The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF |
Other Names | NKL, NPHP7, GLIS family zinc finger 2 |
Gene, Accession # | GLIS2, Accession: NM_032575 |
Catalog # | TA329653 |
Price | |
Order / More Info | GLIS2 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |